PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.16G118200.1.p
Common NameGLYMA_16G118200
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family FAR1
Protein Properties Length: 88aa    MW: 10074.4 Da    PI: 4.7296
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.16G118200.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR121.57.9e-074879638
                 FAR1  6 YAkevGFsvrkskskkskrngeitkrtfvCske 38
                         Y++ +GFsvrks+  +s + gei+++tf Cs+ 
  Glyma.16G118200.1.p 48 YSRLIGFSVRKSHAVRS-QFGEIVQQTFLCSRG 79
                         99**************9.7777*********85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031011.6E-44879IPR004330FAR1 DNA binding domain
Sequence ? help Back to Top
Protein Sequence    Length: 88 aa     Download sequence    Send to blast
MKKTMVLDSG SPLISFDSMV DIYNIDMHNL TNDEVEHLDF LDWEMAWYSR LIGFSVRKSH  60
AVRSQFGEIV QQTFLCSRGL REDTGLT*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLK7MGS75e-60K7MGS7_SOYBN; Uncharacterized protein
STRINGGLYMA16G22516.11e-59(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF3290752
Representative plantOGRP3012351